← statichum.studio

AI travel planner fact-checker for operating hours, closures, and tides

mobile app real project •• multiple requests

ChatGPT/Gemini travel itineraries keep sending people to closed attractions, wrong tide windows, and ferries that do not run on the planned day. Travelers want a pre-trip fact-check pass that ingests a plain-text itinerary, grounds every timed claim against live sources (official hours, ferry schedules, tide charts, closures), and returns a red/yellow/green report.

builder note

Paste-an-itinerary, get-a-red-yellow-green-report. Start with the five highest-risk claim types (hours, seasonal closure, ferry/train days, tide windows, reservation-required) and grow from there. Don't try to beat the planner itself.

landscape (3 existing solutions)

Every tool in the space wants to generate the plan. No tool positions itself as the trust layer that audits someone else's AI-generated plan.

Google Maps real-time hours Correct for individual places but you must manually check each line of an itinerary
Mindtrip, Wonderplan AI planners These generate itineraries, they do not verify someone else's itinerary against live ground truth
Manual Googling What travelers do today, and the whole problem is that they don't do it thoroughly enough
sources (3)
other https://community.ricksteves.com/travel-forum/tech-tips/the-... "ChatGPT sent us to a museum that has been closed for refurbishment two years" 2026-03-20
other https://copyleaks.com/blog/the-dangers-of-using-ai-travel-pl... "travelers directed to attractions closed for years" 2026-02-15
other https://www.huffpost.com/entry/chatgpt-travel-plans-itinerar... "tragic AI fails... cannot fully rely on ChatGPT" 2026-03-10
travelai-hallucinationfact-checkitinerary

Self-hosters posting in r/selfhosted and on HN State of Homelab 2026 want a simpler, open-source Cloudflare Tunnel replacement that lets them expose Jellyfin, Immich, and similar apps on their own domain without violating streaming ToS. Existing tools either require deep networking knowledge or force reliance on a single commercial gateway.

builder note

The homelab crowd will never pay for the tunnel itself. They will pay for the dashboard, the LetsEncrypt automation, and the 'oh shit my DNS broke' recovery. Sell the control plane, open-source the data plane.

landscape (4 existing solutions)

Plenty of open-source plumbing exists but none of it is packaged as a turnkey product with a UI your less-technical homelab friend could run.

Pangolin Promising but still pre-1.0, no polished UI for non-sysadmins
Boring Proxy Works but abandoned-looking, no multi-tenant dashboard
Rathole High-performance tunnel but CLI-only, no domain-management UI
Cloudflare Tunnel Violates Cloudflare ToS for video streaming and forces dependency on a single vendor
sources (2)
hn https://news.ycombinator.com/item?id=47746577 "cloudflare tunnels are great until they arent... need a self-hosted equivalent" 2026-04-08
reddit https://www.reddit.com/r/selfhosted/ "recurring weekly threads about tunnel ToS for media apps" 2026-04-15
self-hostedhomelabreverse-proxyprivacy

Phantom dependency auditor that spans multiple language ecosystems

dev tool weekend hack •• multiple requests

Maintainers on HN keep complaining about undeclared (phantom) and unused dependencies silently shipping to prod. They want a single CLI/CI tool that reports both cases across package.json, pyproject.toml, go.mod, and Cargo.toml in a polyglot monorepo, with a clean SARIF output for GitHub Actions.

builder note

Do not build a new static analyzer. Shell out to Knip, deptry, and go mod why, normalize their output to SARIF, and charge for the GitHub App that posts inline PR annotations. The unification is the product.

landscape (3 existing solutions)

Every language ecosystem has a point tool. No unified scanner reports phantom + unused deps across the four dominant backend/frontend ecosystems with a shared config.

Knip Excellent for JS/TS, nothing for Python, Go, Rust
depcheck JS/TS only, noisy false positives on monorepos with workspaces
deptry Python only, does not detect phantom deps introduced by transitive imports in other language toolchains
sources (2)
hn https://news.ycombinator.com/item?id=47797632 "phantom deps keep biting us when we move the monorepo" 2026-04-11
hn https://news.ycombinator.com/item?id=47741527 "wrote a tiny unused-dep scanner, went viral because nothing does both langs" 2026-04-07
dependenciesmonoreposupply-chainci-cd

Developers who used to rely on Sourcetrail (archived 2021) keep asking for a successor that can ingest a TypeScript, Python, Rust, or Go repo and give them a clickable, zoomable call graph to reason about unfamiliar codebases. Existing IDE features give local 'peek references' but no whole-repo map.

builder note

Build on tree-sitter + LSP and ship as a local web app (not a VS Code extension) so it works across editors. The wedge is onboarding to a new repo on day one, not replacing go-to-definition.

landscape (3 existing solutions)

The dedicated category essentially died with Sourcetrail. Current tools either target enterprise buyers or give only local hop-by-hop navigation inside an editor.

NumbatUI Community fork of Sourcetrail, early-stage and does not support modern JS/TS monorepos out of the box
Augoor Enterprise-focused code knowledge graph, not something a solo developer can point at a local repo in 5 minutes
IDE Call Hierarchy (VS Code, JetBrains) Single-function drill-down only, no whole-repo map, no cross-language support
sources (2)
hn https://news.ycombinator.com/item?id=46345827 "I'd kill for a Sourcetrail that actually gets maintained" 2026-04-10
other https://github.com/CoatiSoftware/Sourcetrail "development discontinued... community still requesting maintained fork" 2026-04-01
code-navigationdeveloper-toolssourcetrail-alternativevisualization

Family voice-clone scam shield with safe-word coordination

mobile app real project ••• trending

FTC logged 250k AI voice-cloning scam complaints in Q1 2026 and elderly losses passed $2.3B. Families want one shared app that manages a rotating safe-word, lets a daughter/son vet a suspicious call on behalf of a parent in real time, and runs local deepfake detection on incoming audio without uploading voice samples.

builder note

Skip AGI-level detection. The real product is a shared family vault: rotating safe phrase, one-tap 'is this you?' push to a trusted relative, and a short-term audio buffer that only plays back after consent. Price per family, not per device.

landscape (3 existing solutions)

Detection tools exist as corporate point solutions. No consumer product ties family-wide safe-word management, local deepfake scoring, and a 'ping my son' escalation button together.

McAfee Deepfake Detector Single-user antivirus add-on, does not coordinate a family-shared safe word or let a trusted relative vet calls remotely
Hiya Deepfake Voice Detector Enterprise-aimed browser extension and carrier integration, no consumer family plan UX around safe words
Manual family safe-word practice Words get forgotten, never rotated, and there is no shared system to log suspicious attempts across generations
sources (3)
other https://www.unboxfuture.com/2026/04/ai-voice-cloning-scams-t... "FTC received 250,000 complaints... Q1 2026" 2026-04-01
other https://www.savingadvice.com/articles/2026/01/19/10715619_th... "families need a 4-digit code to block 2026 Medicare scams" 2026-01-19
other https://www.ncoa.org/article/what-are-ai-scams-a-guide-for-o... "establish a verification code with loved ones" 2026-03-15
scamselderly-caredeepfakefamilyprivacy

Third-party unfiltered Reddit discovery feed after r/all deprecation

browser extension real project ••• trending

Reddit permanently killed r/all on April 2, 2026, redirecting all traffic to algorithmic Home/r/popular. Longtime users want a third-party client or web app that reconstructs the raw, unpersonalized upvote-ranked firehose across all public subs (old r/all behavior) using the public JSON API plus caching.

builder note

The moat here is not the feed but the rate-limit engineering. Ship a read-only PWA + browser extension that keeps a rolling 6-hour cache so a few hundred users can share one API budget, and charge $2/mo for notification keyword filters.

landscape (3 existing solutions)

No hosted replacement is positioning itself explicitly as the r/all discovery experience. Self-hosted forks exist but suffer from API rate limits and aren't packaged for casual users.

r/popular Curated, excludes NSFW and many niche subs, does not reproduce the raw cross-sub upvote firehose
old.reddit.com r/all Works today but Reddit has stated old.reddit is on borrowed time and most users are on new UI or mobile
Redlib / Libreddit forks Privacy-focused mirror but instances get rate-limited and blocked, not positioned as a discovery product
sources (3)
other https://support.reddithelp.com/hc/en-us/articles/47822249050... "all links to r/all now redirect to the Home feed" 2026-04-02
other https://tech.yahoo.com/social-media/articles/reddit-just-kil... "r/all represented that ethos... not what an algorithm decided" 2026-04-03
other https://nationaltoday.com/us/ca/los-angeles/news/2026/04/03/... "forcing algorithmic feeds... power users push back" 2026-04-03
redditdiscoveryanti-algorithmsurgesocial