ChatGPT/Gemini travel itineraries keep sending people to closed attractions, wrong tide windows, and ferries that do not run on the planned day. Travelers want a pre-trip fact-check pass that ingests a plain-text itinerary, grounds every timed claim against live sources (official hours, ferry schedules, tide charts, closures), and returns a red/yellow/green report.
builder note Paste-an-itinerary, get-a-red-yellow-green-report. Start with the five highest-risk claim types (hours, seasonal closure, ferry/train days, tide windows, reservation-required) and grow from there. Don't try to beat the planner itself.
landscape (3 existing solutions)
Every tool in the space wants to generate the plan. No tool positions itself as the trust layer that audits someone else's AI-generated plan.
Manual Googling What travelers do today, and the whole problem is that they don't do it thoroughly enough sources (3)
travelai-hallucinationfact-checkitinerary
Self-hosters posting in r/selfhosted and on HN State of Homelab 2026 want a simpler, open-source Cloudflare Tunnel replacement that lets them expose Jellyfin, Immich, and similar apps on their own domain without violating streaming ToS. Existing tools either require deep networking knowledge or force reliance on a single commercial gateway.
builder note The homelab crowd will never pay for the tunnel itself. They will pay for the dashboard, the LetsEncrypt automation, and the 'oh shit my DNS broke' recovery. Sell the control plane, open-source the data plane.
landscape (4 existing solutions)
Plenty of open-source plumbing exists but none of it is packaged as a turnkey product with a UI your less-technical homelab friend could run.
Pangolin Promising but still pre-1.0, no polished UI for non-sysadmins Boring Proxy Works but abandoned-looking, no multi-tenant dashboard Rathole High-performance tunnel but CLI-only, no domain-management UI Cloudflare Tunnel Violates Cloudflare ToS for video streaming and forces dependency on a single vendor sources (2)
self-hostedhomelabreverse-proxyprivacy
Maintainers on HN keep complaining about undeclared (phantom) and unused dependencies silently shipping to prod. They want a single CLI/CI tool that reports both cases across package.json, pyproject.toml, go.mod, and Cargo.toml in a polyglot monorepo, with a clean SARIF output for GitHub Actions.
builder note Do not build a new static analyzer. Shell out to Knip, deptry, and go mod why, normalize their output to SARIF, and charge for the GitHub App that posts inline PR annotations. The unification is the product.
landscape (3 existing solutions)
Every language ecosystem has a point tool. No unified scanner reports phantom + unused deps across the four dominant backend/frontend ecosystems with a shared config.
Knip Excellent for JS/TS, nothing for Python, Go, Rust depcheck JS/TS only, noisy false positives on monorepos with workspaces deptry Python only, does not detect phantom deps introduced by transitive imports in other language toolchains sources (2)
dependenciesmonoreposupply-chainci-cd
FTC logged 250k AI voice-cloning scam complaints in Q1 2026 and elderly losses passed $2.3B. Families want one shared app that manages a rotating safe-word, lets a daughter/son vet a suspicious call on behalf of a parent in real time, and runs local deepfake detection on incoming audio without uploading voice samples.
builder note Skip AGI-level detection. The real product is a shared family vault: rotating safe phrase, one-tap 'is this you?' push to a trusted relative, and a short-term audio buffer that only plays back after consent. Price per family, not per device.
landscape (3 existing solutions)
Detection tools exist as corporate point solutions. No consumer product ties family-wide safe-word management, local deepfake scoring, and a 'ping my son' escalation button together.
McAfee Deepfake Detector Single-user antivirus add-on, does not coordinate a family-shared safe word or let a trusted relative vet calls remotely sources (3)
scamselderly-caredeepfakefamilyprivacy
Reddit permanently killed r/all on April 2, 2026, redirecting all traffic to algorithmic Home/r/popular. Longtime users want a third-party client or web app that reconstructs the raw, unpersonalized upvote-ranked firehose across all public subs (old r/all behavior) using the public JSON API plus caching.
builder note The moat here is not the feed but the rate-limit engineering. Ship a read-only PWA + browser extension that keeps a rolling 6-hour cache so a few hundred users can share one API budget, and charge $2/mo for notification keyword filters.
landscape (3 existing solutions)
No hosted replacement is positioning itself explicitly as the r/all discovery experience. Self-hosted forks exist but suffer from API rate limits and aren't packaged for casual users.
r/popular Curated, excludes NSFW and many niche subs, does not reproduce the raw cross-sub upvote firehose old.reddit.com r/all Works today but Reddit has stated old.reddit is on borrowed time and most users are on new UI or mobile Redlib / Libreddit forks Privacy-focused mirror but instances get rate-limited and blocked, not positioned as a discovery product sources (3)
redditdiscoveryanti-algorithmsurgesocial